Stefon Diggs, Cole Beasley activ pentru facturile vs Colts / Super Wild Card week-end

publicitate

raport Inactivități

prezentat de

Jan 09, 2021 la 11:35 AM

Jourdon LaBarber

corespondent colaborator

010921-inactives-listă

receptoarele Buffalo Bills Stefon Diggs și Cole Beasley sunt listate ca active pentru jocul wild-card al echipei împotriva Indianapolis Colts.

Diggs, care a devenit primul receptor Bills care a fost numit vineri în prima echipă AP All-Pro, a fost listat cu o accidentare oblică pe tot parcursul săptămânii. El nu a practicat miercuri și a fost un participant limitat marți și joi. Diggs a condus NFL în recepții (127) și curți de primire (1.535) în acest sezon, ambele înregistrări de franciză.

Beasley a ratat jocul echipei din săptămâna 17 împotriva Miami cu o accidentare la genunchi suferită cu o săptămână înainte împotriva New England. El nu a practicat până joi, când a fost listat ca un participant limitat. Beasley a stabilit maxime în carieră cu 82 de recepții și 967 de metri în acest sezon, câștigând un loc în echipa a doua ap All-Pro.

Diggs, Beasley și John Brown vor fi împreună pentru prima dată din săptămâna 10 la Arizona.

următorii jucători sunt inactivi astăzi:

10 Jake Fromm

22 TJ Yeldon

53 Tyrel Dodson

81 Tyler Kroft

93 Trent Murphy

68 Jordan Devey

82 Ducele Williams

publicitate

mare stânga săgeată pictograma mare săgeată dreapta pictograma Închide pictograma copie URL trei puncte pictograma săgeată în jos pictograma E-Mail icon e-mail icon ieșire Fullscreen icon link extern Icon Facebook logo fotbal icon Facebook logo Instagram logo Snapchat logo YouTube logo Tiktok logo Spotify logo LinkedIn logo grilă pictogramă cheie pictogramă săgeată stânga pictogramă Link pictogramă locație pictogramă e-mail Pictogramă meniu pictogramă deschisă pictogramă telefon pictogramă redare pictogramă Radio pictogramă Derulare înapoi pictogramă săgeată dreapta pictogramă căutare pictogramă selectați pictograma selectată pictogramă TV pictogramă Twitter logo Twitter logo săgeată sus pictogramă pictogramă utilizator pictogramă audio pictogramă Ticheteadaugă în calendar iconNFC pictogramă AFC pictogramă NFL pictogramă carusel IconList Vizualizarewebsite InstagramTwitterFacebookSnapchatshop IconProfile Overlay AvatarAddAirplayArrow LeftArrow RightArrow UpArrow downaudioback 5sback 10sback 30sCalendarChartCheckDownLeftRightupchromecast OffChromecast OnCloseClosed CaptionsBench OffBench Onbrand Offbrand OnVertical OffVertical OnCommentDockDoneDownloadDraftFantasyfilterforward 5sForward 10sForward 30secran complet off ecran complet Ongamepassgamesinsightskeyleavelivecombinedraftfantasymenu GamesMenu NetworkMenu newsmenu playoffsmenu pro bowlmenu shopmenu standingsmenu Statsmenu Super Bowlmenu Teamsmenu Ticketsmenumore Horizontalmore Verticalmy Locationnetworknetworkspauseplaymultiple Playerssingle Playerplaylistplayoffspro bowlpurgerefreshremovereplayscăutare Setăripartament Androidspartament copie Twitterstandingsstarstatsswapteamsticketsvideovizibilitate URLShare EmailShare FacebookShare InstagramShare iOSShare SnapchatShare Offvisibilitate Onvolum Hivolum Lowvolum Mediumvolum MuteWarningWebsite Caret downCaret upAt

Lasă un răspuns

Adresa ta de email nu va fi publicată.